SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118528 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118528
Domain Number 1 Region: 999-1173
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000114
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118528   Gene: ENSMUSG00000035969   Transcript: ENSMUST00000131668
Sequence length 1462
Comment pep:known chromosome:GRCm38:4:43414696:43427088:1 gene:ENSMUSG00000035969 transcript:ENSMUST00000131668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLELSRMDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGAGGGGGGTRANPFCPPELGL
TQPDHDLGQADSLLYPSLHSAPGAPTGSSDSVKSRSRDGRGPGAPKRHNPFLVQEGVGET
GLGDLHDSSTGDSVTQQSFHLHSASQPFHLSSFQLPPSGPGQGRPWGATHSRPGVVEGQE
QDPATALGTQCSTSHCCRPELEAERMELDECGGHGGSGSGGGTSDISGFSFEQEWKISSD
ESPRHPGRSGSGTQHCHCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHSS
SRANLNSVPQSCSDSSFCSHADPGAFYLDLQPSPAESRMSCESHHPENGDREEGCGCPHV
SSPELDANCNAYHPHSEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAG
SSITSCSEEHTKISPPPGPCPDPDPNQPSEYYLFQKPDIQPEEQEAVGSPAEAATAMGPT
VLEGQVYTNTSPPNLNTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPAALAGP
ASPPRRVTSFAELAKGRKKAAGSGSPPLRASVGDSSQEFSPIQEAQQDRAAPLDEGTRCS
HSLPSLPLGPSLDLLGPEPWSTPVCQGSQSSEMPLPSLRAAGQGPLAQLMDPGPAFSGSP
ATSHTQRDSRARADGGGTESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHSLS
QLYSLSMPCSRAQQPAPLVISTAQGPAPAPSGEPQPFTSQASGRGARNAGPEPETSRPSP
LGSYSPVRSAGPFGSSTDSSASTSCSPPPEQGTAADSVSPWSHTCPPTVRPATSQQPPKE
DQKIPTLAEYRLHGTGSLPPLGSWRSGFTRAESLVRGGGEGSMANRPNNANHLSPQALKW
REYRRKNPLGPPGLSGSLDRRPPEARLARRNPIFEFPGSFGTTSHLNCRLNGQISKPLSL
TCPDLQDPFSLTEKPPAEFCLSPDGNSEAISIDILQKKGLVKAVNTAVDLIVAHFGTSRD
PGVKAKLGNSSVSPNVGHLVLKYLCPAVQAVLEDGLKAFVLDVIIGQRKNMPWSVVEAST
QLGPSTKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHY
QPWGFLRAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGRQQRQHKELLRVSQ
DLLLSAHSTLQLARSRGQEGPGDMDRVAPGERVKGVGASEGGEEDEEDAEEVAVVAGSSD
HGKWARGGQAGWWYQLMQSSQVYIDGTAEGSRFPRSSSSSSGSGSEKKKGVGSGGPSQAP
PPPPREGVVEGAEACPAPEEALGQERGWPFWMGSPPDSVLAELRRSREREGPVAPPTENE
EGTAEPSPGGIKWGHLFGSRKSQREARPTNRLPSDWLSLDKSVFQLVAQTMGARREPEPR
ENLQESHPPAVPSKPPWYAQGN
Download sequence
Identical sequences G8JL85
ENSMUSP00000118528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]