SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118534 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118534
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.44e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118534   Gene: ENSMUSG00000040181   Transcript: ENSMUST00000131058
Sequence length 209
Comment pep:known chromosome:GRCm38:1:162839618:162859714:-1 gene:ENSMUSG00000040181 transcript:ENSMUST00000131058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVS
NSSREMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFA
VSGQWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPGILTFKGEYFHSRQYKHPD
IFKDKRVLVVGMGNSGTDIAVEASHLAKK
Download sequence
Identical sequences ENSMUSP00000118534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]