SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118615 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118615
Domain Number 1 Region: 86-170
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-33
Family Nuclear receptor 0.0000126
Further Details:      
 
Domain Number 2 Region: 156-220
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000288
Family Nuclear receptor ligand-binding domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118615   Gene: ENSMUSG00000001288   Transcript: ENSMUST00000135466
Sequence length 227
Comment pep:putative chromosome:GRCm38:15:102239989:102257349:-1 gene:ENSMUSG00000001288 transcript:ENSMUST00000135466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLW
Download sequence
Identical sequences D3YZY4
ENSMUSP00000118615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]