SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119174 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119174
Domain Number 1 Region: 8-51
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 0.000000000000248
Family TRADD, N-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119174   Gene: ENSMUSG00000031887   Transcript: ENSMUST00000144762
Sequence length 64
Comment pep:known chromosome:GRCm38:8:105259283:105264581:-1 gene:ENSMUSG00000031887 transcript:ENSMUST00000144762 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSARPAQGRGTR
GAGG
Download sequence
Identical sequences D6RCI0
ENSMUSP00000119174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]