SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119475 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119475
Domain Number 1 Region: 92-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000527
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 2 Region: 67-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000528
Family Follistatin (FS) module N-terminal domain, FS-N 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119475   Gene: ENSMUSG00000018593   Transcript: ENSMUST00000141530
Sequence length 172
Comment pep:known chromosome:GRCm38:11:55399252:55419898:-1 gene:ENSMUSG00000018593 transcript:ENSMUST00000141530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGRALAAPTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETV
EEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSC
HFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVL
Download sequence
Identical sequences Q5NCU3
ENSMUSP00000119475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]