SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119961 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000119961
Domain Number - Region: 139-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 53-103
Classification Level Classification E-value
Superfamily L domain-like 0.00194
Family Internalin LRR domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119961   Gene: ENSMUSG00000013622   Transcript: ENSMUST00000153643
Sequence length 183
Comment pep:putative chromosome:GRCm38:5:31048722:31054344:1 gene:ENSMUSG00000013622 transcript:ENSMUST00000153643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLGVERALALPEICTLCPGGMHNLSRVAAYCEDTSKLMQARCCLNQKGTILGLDLQNCSL
KDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTS
FKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQPSPFYFG
EPS
Download sequence
Identical sequences F6RYG0
ENSMUSP00000119961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]