SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120073 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120073
Domain Number 1 Region: 31-192
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.06e-32
Family Inositol polyphosphate kinase (IPK) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120073   Gene: ENSMUSG00000060733   Transcript: ENSMUST00000147277
Sequence length 216
Comment pep:known chromosome:GRCm38:10:71347836:71382239:1 gene:ENSMUSG00000060733 transcript:ENSMUST00000147277 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQL
QPPPRGPRELEFYTMVYAADCADAVLLELRKHLPKYYGVWSPPTAPNDVYLKLEDVTHKF
NKPCIMDVKIGRKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQH
YGRGLTKETLKEGEPWSGAAAAVSKMALTRFSSPLE
Download sequence
Identical sequences ENSMUSP00000113083 ENSMUSP00000120073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]