SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120284 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120284
Domain Number 1 Region: 49-119
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000327
Family FAD-linked reductases, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120284   Gene: ENSMUSG00000039048   Transcript: ENSMUST00000151658
Sequence length 140
Comment pep:known chromosome:GRCm38:9:35204208:35211001:-1 gene:ENSMUSG00000039048 transcript:ENSMUST00000151658 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MFRRALRLGLGPGLPYRGLRTRKGGFTLDWDAKVSDFKKKVDSILPGKKYEVLYDTSHLP
PEQADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTVSIHGLPPQGLLWAGFGS
SFPCLRMSSSHSFQSTFSGT
Download sequence
Identical sequences D6RJ42
ENSMUSP00000120284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]