SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120419 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000120419
Domain Number - Region: 7-33
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0706
Family Skp1 dimerisation domain-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120419   Gene: ENSMUSG00000020864   Transcript: ENSMUST00000149867
Sequence length 68
Comment pep:putative chromosome:GRCm38:11:94333453:94334583:1 gene:ENSMUSG00000020864 transcript:ENSMUST00000149867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQLTSRREIRKIMGVEEADEEEEIPQLKKESELPFVPNYLANPAFPFIYTPAAEDSTQ
LQNGGPSP
Download sequence
Identical sequences B7ZC98
ENSMUSP00000120419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]