SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120478 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120478
Domain Number 1 Region: 68-202
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-22
Family FAD-linked reductases, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120478   Gene: ENSMUSG00000009614   Transcript: ENSMUST00000149733
Sequence length 203
Comment pep:known chromosome:GRCm38:2:27241469:27246848:-1 gene:ENSMUSG00000009614 transcript:ENSMUST00000149733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRVLRVAATCPRGRAAWNLGLQPLATEARPTTEKSVPYQRTLKEEAQGASVVPQGP
SQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIES
HVLSPAETKSLYPLMNVDDLYGT
Download sequence
Identical sequences A2AH53
ENSMUSP00000120478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]