SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120502 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000120502
Domain Number - Region: 8-71
Classification Level Classification E-value
Superfamily MIT domain 0.000128
Family MIT domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120502   Gene: ENSMUSG00000041298   Transcript: ENSMUST00000147473
Sequence length 209
Comment pep:known chromosome:GRCm38:5:148893775:148995147:-1 gene:ENSMUSG00000041298 transcript:ENSMUST00000147473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLAEICENAKKGREYALLGNYDSSMVYYQGVIQQIQRHCQSLRDPATKAKWQQVRQELL
EEYEQVKSIVSTLESFKMDKPPDFPVSCRDEPFRDPAVWPPPVPAEHRAPPQIRRPNREV
RPLRKDVGAGARGLVGRAHQISKSDKPASRDKDYRARGRDDKARKNVQDGASDSEIPKFD
GAGYDKDLVEALERDIVSRNPSIHWDDIA
Download sequence
Identical sequences D3YYB5
ENSMUSP00000120502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]