SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120630 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120630
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily Ras GEF 5.75e-22
Family Ras GEF 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120630   Gene: ENSMUSG00000032946   Transcript: ENSMUST00000146831
Sequence length 164
Comment pep:known chromosome:GRCm38:19:6400547:6404421:1 gene:ENSMUSG00000032946 transcript:ENSMUST00000146831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTY
Download sequence
Identical sequences D3YXD6
ENSMUSP00000120630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]