SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120893 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120893
Domain Number 1 Region: 34-225
Classification Level Classification E-value
Superfamily Ferritin-like 2.61e-78
Family Ribonucleotide reductase-like 0.00000000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120893   Gene: ENSMUSG00000020649   Transcript: ENSMUST00000153058
Sequence length 225
Comment pep:putative chromosome:GRCm38:12:24708752:24711769:1 gene:ENSMUSG00000020649 transcript:ENSMUST00000153058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHWLAVSCGSVGIWGLVHLALSLIQQESKAPTNPSVEDEPLLRENPRRFVVFPIEYHDI
WQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFS
QEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWA
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGL
Download sequence
Identical sequences D3Z0D8
ENSMUSP00000120893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]