SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120949 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120949
Domain Number 1 Region: 9-94
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000000000615
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120949   Gene: ENSMUSG00000032946   Transcript: ENSMUST00000150713
Sequence length 95
Comment pep:known chromosome:GRCm38:19:6399868:6403478:1 gene:ENSMUSG00000032946 transcript:ENSMUST00000150713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPE
Download sequence
Identical sequences D3YZX2
ENSMUSP00000120949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]