SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120955 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000120955
Domain Number - Region: 28-130
Classification Level Classification E-value
Superfamily Tropomyosin 0.000817
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120955   Gene: ENSMUSG00000026289   Transcript: ENSMUST00000144047
Sequence length 154
Comment pep:putative chromosome:GRCm38:1:87755870:87771398:1 gene:ENSMUSG00000026289 transcript:ENSMUST00000144047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQKDK
EIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRK
TTEENQELVTRWMAEKAQEANRLNAENEKDSRRR
Download sequence
Identical sequences D3YZW7
ENSMUSP00000120955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]