SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121317 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121317
Domain Number 1 Region: 357-501
Classification Level Classification E-value
Superfamily CBS-domain pair 2.86e-17
Family CBS-domain pair 0.0068
Further Details:      
 
Domain Number 2 Region: 576-626,673-716
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000344
Family cAMP-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121317   Gene: ENSMUSG00000037408   Transcript: ENSMUST00000153128
Sequence length 771
Comment pep:known chromosome:GRCm38:1:36471620:36508764:1 gene:ENSMUSG00000037408 transcript:ENSMUST00000153128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGGGGGRRDGWPARGRLLLAALLLLWTRAASGQSSPQQSVILGMRLASCNKSCGMNPD
GIIFVSEGSTVNLRLYGHSLGDISSNLISFTEVDDAEAVHNSTNCLELTKDLVVQRLVNV
SRGNTSGMLVVITKFLRRSENMKLYALCTRPRADGPWTRWTDKDSLLFMVEEHGRFLPLW
LHILLVMVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERKYARKIEPIRRKGNYLL
CSLLLGNVLVNTSLTILLDNLIGSGIMAVASSTIGIVIFGEILPQALCSRHGLAVGANTI
VLTKVFMLLTFPLSFPISKLLDFVLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELNMIQ
GALELRTKTVEDIMTQLHDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVDILY
VKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNNEGE
GDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRTRKRVSVKNKRDFSAFKDTDNELK
VKISPQLLLAAHRFLATEVPQFSPSLMSEKILLRLLKYPDVIQELRFNEHNRYCVRHYLY
TRNKPADCFVLILQGKVEVEAGKENMKFETGAFSYYGTMALSVAPPDRSPALPTPLSRSA
SLSYPDRNTDLTSTSLAGSNQFGSCILGQYVSDFSVRALTDLQYIKITRQQYQNGLMASR
MDNSPQPTFDGCATCSENFMERPELPPVDETTTLLNERNSLLHRASEEETI
Download sequence
Identical sequences Q69ZF7
NP_291048.2.92730 ENSMUSP00000121317 ENSMUSP00000121317 10090.ENSMUSP00000121317 ENSMUSP00000121317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]