SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121427 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121427
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-36
Family Carbonic anhydrase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121427   Gene: ENSMUSG00000021745   Transcript: ENSMUST00000155727
Sequence length 128
Comment pep:putative chromosome:GRCm38:14:12091160:12122132:1 gene:ENSMUSG00000021745 transcript:ENSMUST00000155727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSPRDNSALDPIIHGLKGVVHHEKETFLDPFILRDLLPASLGSYYRYTGSLTTPPCSE
IVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQALNDRVVSKSAVR
DAWNHDLA
Download sequence
Identical sequences ENSMUSP00000121427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]