SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121532 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121532
Domain Number 1 Region: 27-203
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.25e-20
Family Eukaryotic proteases 0.0016
Further Details:      
 
Domain Number 2 Region: 228-316
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000271
Family Eukaryotic proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121532   Gene: ENSMUSG00000070371   Transcript: ENSMUST00000150591
Sequence length 323
Comment pep:putative chromosome:GRCm38:7:127932960:127936097:-1 gene:ENSMUSG00000070371 transcript:ENSMUST00000150591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTLLSFPTQQPRTSDSSPHDFETWRVLLPSRPEEERVARLVAHENASRDFASDLALLQL
RTRVNLTAAPSAVCLPHHEHYFLPGSHCRLARWGRGELAPGSSAQLEAQLLNGWWCHCLY
GRQGETVPRPGDPPHLLCPAYQEEEEAGLCWKDSSWSLLCREEGTWFLAGYRTLSDGCLR
PRAFSPMQTHGPWIRHVTQGAYLEDQLTWDWGPEGEETEKQTCPTHTEHGVPVVAAVSIL
TPRLCHCLYPGILTPGTFCVLYSEGQEDRCEVTSAPPLLCQTEEGPWVLVGMAVRGNREL
FAAIGPEATWISQTVGEAHFLHL
Download sequence
Identical sequences ENSMUSP00000121532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]