SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121576 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121576
Domain Number 1 Region: 301-428
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.63e-16
Family cAMP-binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000121576
Domain Number - Region: 145-224,253-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000174
Family cAMP-binding domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121576   Gene: ENSMUSG00000073991   Transcript: ENSMUST00000137780
Sequence length 430
Comment pep:putative chromosome:GRCm38:4:18860454:19122526:-1 gene:ENSMUSG00000073991 transcript:ENSMUST00000137780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDSLPNSILAHMLAISNVPPPPLHSLPRLRLSKTINYGQLNALCHIRGLKSDQHSSLR
SEAHDAFIKQYPQIFLREKTVLPKVSHQVDKRKSALKLAEKKHQPVMAHNISAYLREARG
GPSIDEKEITEEKFQEFLNILKKLPVYRTTHEHNMVWKILQSIPELTSQFSNEDLKILSK
KVISETWIKGSTVIGDDGLYVLLTGQARRRVKVFRSLIEENDSIITSLYRDSFLFDAELQ
DSTVAQLYVPSKKLIVKQWGIFGSLKDRAEMDERDRSVVTDYDCEILKIAAKEYEKLKLE
KVKHENAQKLKLIRKCPFYETWPTLSIWELVSICKFKNFPPGHVLVESGTVISFVGYINS
GYCNIYRNVVGLVDLPINKVKKIKKLVYMGKLKEKESFGEISILLQAPFTCTVITGQEVE
MAVIEDKDIQ
Download sequence
Identical sequences B1AWM0
ENSMUSP00000121576 ENSMUSP00000121576 10090.ENSMUSP00000095849 ENSMUSP00000121576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]