SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121635 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121635
Domain Number 1 Region: 9-231
Classification Level Classification E-value
Superfamily Ras GEF 2.75e-44
Family Ras GEF 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121635   Gene: ENSMUSG00000032946   Transcript: ENSMUST00000138555
Sequence length 231
Comment pep:known chromosome:GRCm38:19:6400564:6404824:1 gene:ENSMUSG00000032946 transcript:ENSMUST00000138555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVA
Download sequence
Identical sequences D3Z2F9
ENSMUSP00000121635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]