SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121740 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121740
Domain Number 1 Region: 43-108
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.21e-16
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 237-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000109
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 144-201
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000333
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121740   Gene: ENSMUSG00000028347   Transcript: ENSMUST00000130834
Sequence length 346
Comment pep:known chromosome:GRCm38:4:48585551:48662470:1 gene:ENSMUSG00000028347 transcript:ENSMUST00000130834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCLPGSRASNQPAGGGGDCPGGRGKSNCSELNLRESDIRVCDESSCKYGGVCKEDGDGL
KCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKDITVVARGPCYSDNGSGSGEGA
EEEGSGAGAHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPC
FVREASCIKQEQIDIRHLGHCTDTDDVSLLGKKDDGLQYRPDVKDAGDEREDVYIGSHMP
CPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAA
IIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences A0A0A0MQL0
ENSMUSP00000121740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]