SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121888 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000121888
Domain Number - Region: 30-100
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121888   Gene: ENSMUSG00000023990   Transcript: ENSMUST00000125177
Sequence length 105
Comment pep:putative chromosome:GRCm38:17:47759175:47786196:1 gene:ENSMUSG00000023990 transcript:ENSMUST00000125177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTLSGLSPLLSLQRAGLAASGYPFHREPEPTAAMASRIGLRMQLMREQAQQEEQRERM
QQQAVMHYMQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVLK
Download sequence
Identical sequences D3Z1X9
ENSMUSP00000121888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]