SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122065 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122065
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-17
Family SH2 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122065   Gene: ENSMUSG00000031834   Transcript: ENSMUST00000143785
Sequence length 71
Comment pep:putative chromosome:GRCm38:8:70768461:70769388:-1 gene:ENSMUSG00000031834 transcript:ENSMUST00000143785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KINEWLGIKNETEDQYSLMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRES
SQRGCYACSVV
Download sequence
Identical sequences F7CB91
ENSMUSP00000122065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]