SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122538 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122538
Domain Number 1 Region: 43-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000149
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122538   Gene: ENSMUSG00000024269   Transcript: ENSMUST00000148255
Sequence length 241
Comment pep:putative chromosome:GRCm38:18:25127223:25168694:-1 gene:ENSMUSG00000024269 transcript:ENSMUST00000148255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETTPPLQAGSKPHLEKLTLGVTRILESSPGVTEVSIIEKLPAERHMISSWEQKNNCVM
PEDVRNFYLMTNGFHMTWSVKLDEHIIPLGSMVINGISKLTQLIQSSVYSLPNAPTLADL
EDDTQEGNEDHQLEKPHFDCRSAIFELDSCNGNGKVCLVYKNGKPGLAHDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKVASIYSQEESMNFQATSVRNQ
W
Download sequence
Identical sequences E9PUD7
NP_001136170.1.92730 ENSMUSP00000122538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]