SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122658 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122658
Domain Number 1 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122658   Gene: ENSMUSG00000048728   Transcript: ENSMUST00000125749
Sequence length 122
Comment pep:known chromosome:GRCm38:11:50877882:50887651:-1 gene:ENSMUSG00000048728 transcript:ENSMUST00000125749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSQLPALVQDLVTFKDVAVLFTQEEWGQLSSAQRALYQDVMLENYSNLVSLAGLLGSQ
PDMFFPLEEVEECVSEEAPEGFVLDAADEPHLGPRSACEAQVPVTENRGVGYHSRQGTSK
YQ
Download sequence
Identical sequences Q5NCH5
ENSMUSP00000122658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]