SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122746 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000122746
Domain Number - Region: 2-63
Classification Level Classification E-value
Superfamily Ras GEF 0.000432
Family Ras GEF 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122746   Gene: ENSMUSG00000022469   Transcript: ENSMUST00000134371
Sequence length 71
Comment pep:known chromosome:GRCm38:15:97757454:97758842:-1 gene:ENSMUSG00000022469 transcript:ENSMUST00000134371 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XDVEAKTMRLEEHGKVVLVLERTSQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMRP
DSSAHDPTGEL
Download sequence
Identical sequences F7BXV7
ENSMUSP00000122746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]