SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123009 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123009
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily MIT domain 4.19e-24
Family MIT domain 0.00000641
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000123009
Domain Number - Region: 169-213
Classification Level Classification E-value
Superfamily PHP domain-like 0.0628
Family PHP domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123009   Gene: ENSMUSG00000026088   Transcript: ENSMUST00000139725
Sequence length 249
Comment pep:known chromosome:GRCm38:1:37874801:37890407:-1 gene:ENSMUSG00000026088 transcript:ENSMUST00000139725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSSLGQDSDSTAAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRCV
LRTKISGYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLHETVTEVWI
EDPYIRQTHQLYNFLRFCEMLIKKPCKVRTIHLLTSGYEGLGNTQQSSGLEEIKQSLGSH
GVVLEINYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQGRFSLGYYDLDLRPCHETTVDI
FHNKHTKKI
Download sequence
Identical sequences Q8VDV8
ENSMUSP00000027257 ENSMUSP00000123009 10090.ENSMUSP00000027257 NP_081189.1.92730 354586 ENSMUSP00000027257 ENSMUSP00000027257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]