SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123036 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123036
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily Ras GEF 8.37e-17
Family Ras GEF 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123036   Gene: ENSMUSG00000032946   Transcript: ENSMUST00000139522
Sequence length 125
Comment pep:known chromosome:GRCm38:19:6399874:6404337:1 gene:ENSMUSG00000032946 transcript:ENSMUST00000139522 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVL
Download sequence
Identical sequences D6RDD3
ENSMUSP00000123036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]