SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123170 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000123170
Domain Number - Region: 3-25
Classification Level Classification E-value
Superfamily SNARE-like 0.00101
Family Synatpobrevin N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123170   Gene: ENSMUSG00000061536   Transcript: ENSMUST00000154978
Sequence length 33
Comment pep:known chromosome:GRCm38:9:121695616:121705490:-1 gene:ENSMUSG00000061536 transcript:ENSMUST00000154978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMILFASIVRVRDGLPLSASTDFYYAQEFLEC
Download sequence
Identical sequences ENSMUSP00000123170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]