SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123216 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123216
Domain Number 1 Region: 402-707
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.99e-103
Family PDEase 0.000000594
Further Details:      
 
Domain Number 2 Region: 188-379
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-48
Family GAF domain 0.0000316
Further Details:      
 
Domain Number 3 Region: 29-180
Classification Level Classification E-value
Superfamily GAF domain-like 7.41e-21
Family GAF domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123216   Gene: ENSMUSG00000023868   Transcript: ENSMUST00000149440
Sequence length 727
Comment pep:novel chromosome:GRCm38:17:8924143:8984288:1 gene:ENSMUSG00000023868 transcript:ENSMUST00000149440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPGQYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIRIATKADGFALYFLGE
CNNSLCVFIPPGMKEGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGDERFPRGTGL
ESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQV
CRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKEL
YSDLFDIGEEKEGKPIFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLY
TGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYH
RIRHSECIYRVTMEKLSYHSICTSEEWQGLMRFNLPARICRDIELFHFDIGPFENMWPGI
FVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNNGLFT
DLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHN
IFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLHNQSHRDRVIGLM
MTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRDEVPQGQLGF
YNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRGEETAMWISGPGPAPSKSTPEK
LNVKVED
Download sequence
Identical sequences ENSMUSP00000123216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]