SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123286 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123286
Domain Number 1 Region: 118-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-33
Family cAMP-binding domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 7.06e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123286   Gene: ENSMUSG00000025855   Transcript: ENSMUST00000148002
Sequence length 251
Comment pep:known chromosome:GRCm38:5:139042451:139127805:-1 gene:ENSMUSG00000025855 transcript:ENSMUST00000148002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSCFHSEDEDSLKGCEMYVQKHGIQQVLKECIVHLCVAKPDRPLRFLREHFEKLEKE
ENRQILARQKSNSQCDSHDEEISPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLS
Download sequence
Identical sequences D3Z068
ENSMUSP00000123286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]