SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123311 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123311
Domain Number 1 Region: 71-140
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.0000162
Family CCP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123311   Gene: ENSMUSG00000006143   Transcript: ENSMUST00000156530
Sequence length 280
Comment pep:novel chromosome:GRCm38:5:136057311:136064319:1 gene:ENSMUSG00000006143 transcript:ENSMUST00000156530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQAAQPRRTEQLGLHSRGPGRKDSSWKLSPAMGPHGKQSVLRMPLLLLLTCVQSGTGLES
INYAPQLLGATLEGRLTQSTFTLEQPLGQFKNVNLSDPDPIWLVVAHSNAAQNFTAPRKV
EDRHAPANFDRNGYYLTLRANRVHYKGGQPDSQLRVLRVGNDNNCSLESQGCNSPLPGAG
PYRVKFLAMSAEGPVAETLWSEEIYLQQAQTFREAPGSQGKGTVVIIAFLSILLAILLVV
FLVLVISACLSTSGSSPEEQVRMRHYHTHHMGSLRAERSS
Download sequence
Identical sequences ENSMUSP00000123311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]