SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123371 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000123371
Domain Number - Region: 141-166
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00671
Family Myeloperoxidase-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123371   Gene: ENSMUSG00000009350   Transcript: ENSMUST00000143021
Sequence length 167
Comment pep:known chromosome:GRCm38:11:87793795:87796046:1 gene:ENSMUSG00000009350 transcript:ENSMUST00000143021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLALAGLLAPLAMLQTSNGATPALLGEVENSVVLSCMEEAKQLVDRAYKERRESIKR
SLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLLKRKLQPLWPRPFNVTDVLTP
AQLNLLSVSSGCAYQDVRVTCPPNDKYRTITGHCNNRRSPTLGASNR
Download sequence
Identical sequences ENSMUSP00000123371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]