SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123476 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123476
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0042
Further Details:      
 
Domain Number 2 Region: 302-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.31e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123476   Gene: ENSMUSG00000086056   Transcript: ENSMUST00000143922
Sequence length 538
Comment pep:novel chromosome:GRCm38:1:166483613:166497588:-1 gene:ENSMUSG00000086056 transcript:ENSMUST00000143922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKQIAIIGAGVSGLGAIKSCLEEGLEPTCFEKSNDIGGLWRYKETPENGRPGIYKSLT
CNTSKEMTTFSDYPIPDHYPNYMHHSKMMEYLRMYARHFGLMKHIQFQTRVCVVRKRPDF
SSSGQWDVVVEADGKQKNYIFDGVMVCSGHYTEKYLPLQDFAGISKFQGSCLHSWEYKHP
DSFVGKRVVVIGIGNSGADVANEISCVTEQVFLSTRRGTWIWNRVWDNGDPLDIALFTRY
NRTVKSFYPTFLINRWTENKLNLRFNHANYGLQAKHRFLSHQSIFSDDLPNRIISGRVLV
KTNVREFTSTSAIFEDGSEEIVDVVVFATGYTLSFPFLDDSSEILDSKHTMFKFVFPPQL
EKPTLAFIGILQPIGATIPTSELQSRWVTRVFAGLQKLPSQSNMMADINRKKRKMEKEFV
KSPRDVRRVPYIDYMDEIASEIGVKPNLLSFFLWDTKLAKEIFWGPCTPYQYRLQGPGKW
AGARAAILTQRDRILKPLRSRVLKNSETSSSSLFWVRCICAVIFPFVSVFAIIHAIYQ
Download sequence
Identical sequences B2RWH8
ENSMUSP00000123476 10090.ENSMUSP00000123476 ENSMUSP00000123476 ENSMUSP00000123476 NP_001157778.1.92730 XP_006496848.2.92730 XP_006496849.1.92730 XP_006496850.1.92730 XP_006496851.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]