SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123511 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123511
Domain Number 1 Region: 33-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-31
Family Nuclear receptor 0.00011
Further Details:      
 
Domain Number 2 Region: 102-191
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000708
Family Nuclear receptor ligand-binding domain 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123511   Gene: ENSMUSG00000017950   Transcript: ENSMUST00000137449
Sequence length 191
Comment pep:known chromosome:GRCm38:2:163550083:163559109:1 gene:ENSMUSG00000017950 transcript:ENSMUST00000137449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGQLREMMMLCLTDTSPSEGANLNSSNSLGVSALCAICGDRATGKHYGASSCDGCKGFF
RRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSY
EDSSLPSINALLQAEVLSQQITSPISGINGDIRAKKIANITDVCESMKEQLLVLVEWAKY
IPAFCELLLDD
Download sequence
Identical sequences A2A5I6
ENSMUSP00000123511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]