SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123553 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123553
Domain Number 1 Region: 26-131
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 2.09e-36
Family NIF3 (NGG1p interacting factor 3)-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123553   Gene: ENSMUSG00000026036   Transcript: ENSMUST00000151272
Sequence length 131
Comment pep:known chromosome:GRCm38:1:58445729:58448050:1 gene:ENSMUSG00000026036 transcript:ENSMUST00000151272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSAHLVPTSVQRAQSWICRSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPP
HTVNTLFLTNDLTEEVMDEALQKKADFILSYHPPIFRPMKHITWKTWKECLVIRALENRV
AVYSPHTAYDA
Download sequence
Identical sequences D3YYF0
ENSMUSP00000123553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]