SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123662 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123662
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.97e-17
Family Phosphofructokinase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123662   Gene: ENSMUSG00000021196   Transcript: ENSMUST00000133041
Sequence length 82
Comment pep:known chromosome:GRCm38:13:6582473:6598760:-1 gene:ENSMUSG00000021196 transcript:ENSMUST00000133041 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XLIIGGFEAYLGLLELAAAREKHEAFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDD
LEARLSGWLLQSLLLLLDVRPH
Download sequence
Identical sequences F6VP95
ENSMUSP00000123662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]