SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124158 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000124158
Domain Number - Region: 30-59
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.0837
Family Ribosomal protein S18 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124158   Gene: ENSMUSG00000032280   Transcript: ENSMUST00000160541
Sequence length 81
Comment pep:putative chromosome:GRCm38:9:61373482:61401892:1 gene:ENSMUSG00000032280 transcript:ENSMUST00000160541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTM
TELNAIIGQQQLQAQHLSHAT
Download sequence
Identical sequences E0CYI6
ENSMUSP00000124158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]