SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124410 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124410
Domain Number 1 Region: 27-68
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000000837
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124410   Gene: ENSMUSG00000006014   Transcript: ENSMUST00000159035
Sequence length 99
Comment pep:novel chromosome:GRCm38:1:150458192:150466165:-1 gene:ENSMUSG00000006014 transcript:ENSMUST00000159035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWKILPVCLSLLLPVVLIQQVSSQELSCKGRCFESFARGRECDCDSQCKQYGKCCADYD
SFCEEVHNPTSPSPKTAPPPPGASHTIKSTTKRSPKSPK
Download sequence
Identical sequences E0CY90
ENSMUSP00000124410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]