SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124440 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124440
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily Terpenoid synthases 0.0000000000000253
Family Isoprenyl diphosphate synthases 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124440   Gene: ENSMUSG00000038240   Transcript: ENSMUST00000162008
Sequence length 138
Comment pep:known chromosome:GRCm38:10:43393921:43440248:1 gene:ENSMUSG00000038240 transcript:ENSMUST00000162008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFLSHCALLAKSCQAAMELAKHDAAVQDMAFQYGKHMAMSHKINADLQPFIKDKASDSKT
FNLNSAPVVLHQEFLGRDLWIKQIGELRETIKAGKGVTSAIDLCRYHGNKALEALESFPP
SEARSALENIVFAVTRFS
Download sequence
Identical sequences F6T4Z4
ENSMUSP00000124440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]