SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124491 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124491
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily PH domain-like 2.84e-26
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124491   Gene: ENSMUSG00000036834   Transcript: ENSMUST00000159188
Sequence length 135
Comment pep:putative chromosome:GRCm38:3:63781377:63899442:-1 gene:ENSMUSG00000036834 transcript:ENSMUST00000159188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYWNGEKRNCVQYRRHFLVDNRVFHVERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHR
TRLRWRPSRKSEKAKILIDSIYKVTEGRQSEIFHRQAEGNFDPSCCFTIYHGNHMESLDL
ITSNPEEARTWITGL
Download sequence
Identical sequences E0CY47
ENSMUSP00000124491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]