SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124521 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124521
Domain Number 1 Region: 5-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124521   Gene: ENSMUSG00000032425   Transcript: ENSMUST00000160652
Sequence length 48
Comment pep:known chromosome:GRCm38:9:88548044:88567286:1 gene:ENSMUSG00000032425 transcript:ENSMUST00000160652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEYVELVSFEDVTVKFTWEEWQNLNDAQKMLYRSVMLETYNSLLSLG
Download sequence
Identical sequences ENSMUSP00000124521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]