SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124801 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124801
Domain Number 1 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000654
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124801   Gene: ENSMUSG00000006014   Transcript: ENSMUST00000161320
Sequence length 179
Comment pep:novel chromosome:GRCm38:1:150455997:150466165:-1 gene:ENSMUSG00000006014 transcript:ENSMUST00000161320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWKILPVCLSLLLPVVLIQQVSSQELSCKGRCFESFARGRECDCDSQCKQYGKCCADYD
SFCEEVKDNKKNTPKKKPNPEPPAVDEAGSGLDNGEFKLTPPPPDPPTTPHSKVTTSPKT
TAAKPVTPKPSLAPNSETSKEASLASNKETTVETKETTATNKQSSASKKKTTSAKETRS
Download sequence
Identical sequences E0CXA1
ENSMUSP00000124801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]