SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124908 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124908
Domain Number 1 Region: 55-425
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-81
Family Ras GEF 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124908   Gene: ENSMUSG00000030589   Transcript: ENSMUST00000160194
Sequence length 428
Comment pep:novel chromosome:GRCm38:7:29135006:29148547:1 gene:ENSMUSG00000030589 transcript:ENSMUST00000160194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKDIKRKSHQECSGKAGGRGRSRQARRHKTCPTPREISKVMASMNLGVLSESSCSEDE
LLEECIRCFDSAGSLRRGDHILKMVLTMHSWVLPSSELAARLLTSYQKAAKDAQELRQLQ
ICYLVRYWLTHHHEAVHQEPQLEAVISRFWTTVAQEGNMAQRSLGDASSLLSPGGPGPPP
PMSSPGLGKKRKVSLLFDHLETEELAQHLTYLEFRSFQAITGSVRGCPALEGSVGLSNSV
SRWVQVMVLSRPGPAQRAQVLDKFIRVAQRLHQLQNFNTLMAVTGGLCHSAISRLKDSHV
HLSPDSTKALLELTELLSSHNNYAHYRRTWAGCTGFRLPVLGVHLKDLVSLYEAHPDRLP
DGRLHLPKLNSLYLRLQELMALQGQHPPCSANEDLLHLLTLSLDLFYTEDEIYELSYARE
PRCPKSLP
Download sequence
Identical sequences ENSMUSP00000124908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]