SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124963 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124963
Domain Number 1 Region: 443-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-87
Family Protein kinases, catalytic subunit 0.000000199
Further Details:      
 
Domain Number 2 Region: 275-400
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.06e-32
Family cAMP-binding domain 0.00096
Further Details:      
 
Domain Number 3 Region: 151-269
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-27
Family cAMP-binding domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124963   Gene: ENSMUSG00000029334   Transcript: ENSMUST00000161490
Sequence length 762
Comment pep:known chromosome:GRCm38:5:98929773:99037351:-1 gene:ENSMUSG00000029334 transcript:ENSMUST00000161490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGSVKPKHAKHPDGHSGNLSNEALRSKVLELERELRRKDAELQEREYHLKELREQLAK
QTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRS
MSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF
Download sequence
Identical sequences Q8CAH8
ENSMUSP00000031277 ENSMUSP00000124963 10090.ENSMUSP00000031277 ENSMUSP00000124963 NP_032952.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]