SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125003 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125003
Domain Number 1 Region: 25-133
Classification Level Classification E-value
Superfamily PWI domain 3.01e-44
Family PWI domain 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125003   Gene: ENSMUSG00000028809   Transcript: ENSMUST00000136342
Sequence length 923
Comment pep:known chromosome:GRCm38:4:135321094:135353244:-1 gene:ENSMUSG00000028809 transcript:ENSMUST00000136342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASLKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKSPELPEPSVRMKDSSVQEATS
TSDILKAPKPEPVPEPKEPSPEKNSKKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRH
RSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPGRRRRRSSASLSGSSSSS
SSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSSPATPPPKTRHSPTPQQSNR
TRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGSKMAAADSVQQR
RQYRRQNQQSSSDSGSSSTSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSP
RMQMGKRWQSPVTKSSRRRRSPSPPPARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRRRT
PSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPP
KQRSPTVTKRRSPSLSSKHRKGSSPGRSTREARSPQPNKRHSPSPRPRAPQTSSPPPVRR
GASASPQGRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPAAK
KPPAPPSPVQSQSPSTNWSPAVPAKKAKSPTPSLSPARNSDQEGGGKKKKKKKDKKHKKD
KKHKKHKKHKKEKAVTIATPATAAPAAVSAATTTSAQEEPAAAPEPRKETESEAEDDNLD
DLERHLREKALRSMRKAQVSPQS
Download sequence
Identical sequences E9PUK6
ENSMUSP00000101487 NP_058079.2.92730 ENSMUSP00000125003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]