SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125137 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125137
Domain Number 1 Region: 55-459
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-89
Family Ras GEF 0.00089
Further Details:      
 
Domain Number 2 Region: 527-596
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000125137
Domain Number - Region: 464-528
Classification Level Classification E-value
Superfamily EF-hand 0.000303
Family Calbindin D9K 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125137   Gene: ENSMUSG00000030589   Transcript: ENSMUST00000159975
Sequence length 678
Comment pep:novel chromosome:GRCm38:7:29134933:29151615:1 gene:ENSMUSG00000030589 transcript:ENSMUST00000159975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKDIKRKSHQECSGKAGGRGRSRQARRHKTCPTPREISKVMASMNLGVLSESSCSEDE
LLEECIRCFDSAGSLRRGDHILKMVLTMHSWVLPSSELAARLLTSYQKAAKDAQELRQLQ
ICYLVRYWLTHHHEAVHQEPQLEAVISRFWTTVAQEGNMAQRSLGDASSLLSPGGPGPPP
PMSSPGLGKKRKVSLLFDHLETEELAQHLTYLEFRSFQAITPQDLRGYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPAQRAQVLDKFIRVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHVHLSPDSTKALLELTELLSSHNNYAHYRRTWAGCTGFRLPVLGVHLKDLVS
LYEAHPDRLPDGRLHLPKLNSLYLRLQELMALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFKAPVVVEWAQGVTPKPDSVTLGQHVEQLVESVFKNYDP
EGRGSISLEDFERLSGNFPFACHGLHPPPRHGSGSFSREELTKYLLHASAICSKLGLAFL
HAFQEVTFRKPTFCHSCSGFVSTGPLWGVTKQGYRCRDCGLCCHRHCRDQVRVECKKRPE
TKGDPGPPGAPVPATSLPPANCGSEESLSYTLSPDPESGCHLRHAWTQTESSHSSWEPEV
VPCPARVLPSRASSKPSV
Download sequence
Identical sequences ENSMUSP00000125137 NP_001167626.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]