SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125946 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125946
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.76e-64
Family IMD domain 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125946   Gene: ENSMUSG00000018126   Transcript: ENSMUST00000170955
Sequence length 238
Comment pep:known chromosome:GRCm38:15:79270165:79285493:-1 gene:ENSMUSG00000018126 transcript:ENSMUST00000170955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGE
QALQSSTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSCQ
HYEIEYRHRAANLEKCMSELWRMERKRDKNAREMKESVNRLHAQMQAFVSESKRAAELEE
KRRYRFLAEKHLLLSNTFLQFLGRVSRAGESKPRPPGAVVRLRRTQEQERSFLPLCFL
Download sequence
Identical sequences ENSMUSP00000125946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]