SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126185 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000126185
Domain Number - Region: 2-57
Classification Level Classification E-value
Superfamily SIS domain 0.03
Family mono-SIS domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126185   Gene: ENSMUSG00000025404   Transcript: ENSMUST00000164161
Sequence length 102
Comment pep:known chromosome:GRCm38:10:127444311:127498709:1 gene:ENSMUSG00000025404 transcript:ENSMUST00000164161 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEDVEKEGEENGLRQETQDYLVP
FFLDGHPVMAMPGKEPSLIPNSSWCAVWQSVRNPPLHLSMGH
Download sequence
Identical sequences E9Q0F6
ENSMUSP00000126185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]