SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126402 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000126402
Domain Number - Region: 32-53
Classification Level Classification E-value
Superfamily Cupredoxins 0.0146
Family Periplasmic domain of cytochrome c oxidase subunit II 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126402   Gene: ENSMUSG00000044279   Transcript: ENSMUST00000163628
Sequence length 62
Comment pep:putative chromosome:GRCm38:17:57062508:57065164:1 gene:ENSMUSG00000044279 transcript:ENSMUST00000163628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPVFRGYCSHHCGLFHSGSPPYSSG
TV
Download sequence
Identical sequences E9PZ04
ENSMUSP00000126402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]